(data stored in ACNUC7421 zone)

EMBL: CP002157.PE608

CP002157.PE608       Location/Qualifiers
FT   CDS             complement(649694..651502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01736"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99641"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWM7"
FT                   /protein_id="EAQ99641.1"
FT                   /translation="MRQKSVFICLALLLGFSSAFAQIAPDCGNAIPICNNTPVNGGTMG
FT                   YGSDDFNGAQKTGCLEQTTTGAIESNSGWYRFKTGASGQLGFNIGFDTEEDWDFALYKT
FT                   SDCNNLGDPIRCNFFDNQDESAFVGVGQDPTGDVENIQYEDWLQVELGEDYYLLINNFS
FT                   NNNSGFSIQFSGNIFVTNPYDALDCSIINNLLGPPIAACENDIVTLDATTADAINYDWY
FT                   EDLGSGFQPVMGQHNSTLQVTNSGTYRVHVATPTNNNINSYVQVAYSPLPVSFAITDDA
FT                   SCSGSEIYNLSQKDSEVLGVQNPTEFIVSYHSSLTDATNGQNILPRQYTTGNGSQTIYT
FT                   RVTSINNPMCFDASEEFQLTNLETPIMNFETEVYLCAENSSTTIGELSPPNSNYTYMWD
FT                   SGQITSSIVITQAGTYTVTATNSLGGLSCSDVRTINVTESTTPVITDILIEDLQNNNTV
FT                   SIITDVTNNVEYRLNDGDFQTSNVFIDIIPGMHTVTVNDTNGCGTTTEQIVVVGFPKFF
FT                   TPNGDDNNELWHIAGISNLENPVVFIYDRYGKLLKQLSQTDSGWDGHFNGNLLPSSDYW
FT                   FKLTYLDNLGQRSTAKYINNHFSLRR"
     MRQKSVFICL ALLLGFSSAF AQIAPDCGNA IPICNNTPVN GGTMGYGSDD FNGAQKTGCL        60
     EQTTTGAIES NSGWYRFKTG ASGQLGFNIG FDTEEDWDFA LYKTSDCNNL GDPIRCNFFD       120
     NQDESAFVGV GQDPTGDVEN IQYEDWLQVE LGEDYYLLIN NFSNNNSGFS IQFSGNIFVT       180
     NPYDALDCSI INNLLGPPIA ACENDIVTLD ATTADAINYD WYEDLGSGFQ PVMGQHNSTL       240
     QVTNSGTYRV HVATPTNNNI NSYVQVAYSP LPVSFAITDD ASCSGSEIYN LSQKDSEVLG       300
     VQNPTEFIVS YHSSLTDATN GQNILPRQYT TGNGSQTIYT RVTSINNPMC FDASEEFQLT       360
     NLETPIMNFE TEVYLCAENS STTIGELSPP NSNYTYMWDS GQITSSIVIT QAGTYTVTAT       420
     NSLGGLSCSD VRTINVTEST TPVITDILIE DLQNNNTVSI ITDVTNNVEY RLNDGDFQTS       480
     NVFIDIIPGM HTVTVNDTNG CGTTTEQIVV VGFPKFFTPN GDDNNELWHI AGISNLENPV       540
     VFIYDRYGKL LKQLSQTDSG WDGHFNGNLL PSSDYWFKLT YLDNLGQRST AKYINNHFSL       600
     RR                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page