(data stored in ACNUC7421 zone)

EMBL: CP002157.PE617

CP002157.PE617       Location/Qualifiers
FT   CDS             658071..658451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01781"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99650"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN6"
FT                   /protein_id="EAQ99650.1"
FT                   /translation="MPIKLDLRIYDNYLVAEFTGIRETTNELEESIRLWTEVANKCKEH
FT                   DLYKVLAISRLNKILSTSNAFAFAEAFKSIGWNPSYKLAGVAFNKQLFLQYQRQVTFIN
FT                   NFGYQCKSFGNTKEAKKWLEII"
     MPIKLDLRIY DNYLVAEFTG IRETTNELEE SIRLWTEVAN KCKEHDLYKV LAISRLNKIL        60
     STSNAFAFAE AFKSIGWNPS YKLAGVAFNK QLFLQYQRQV TFINNFGYQC KSFGNTKEAK       120
     KWLEII                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page