(data stored in ACNUC7421 zone)

EMBL: CP002157.PE618

CP002157.PE618       Location/Qualifiers
FT   CDS             complement(658521..661493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01786"
FT                   /product="putative protein-export transmembrane SecDF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01786"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99651"
FT                   /db_xref="GOA:A4AWN7"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWN7"
FT                   /protein_id="EAQ99651.1"
FT                   /translation="MQNKGLIKLFAFLFGLVSIYQLSYTFITGKIEKDAEVYASNQITE
FT                   AEENYVSKREALEVRYLDSIGGNPILGYTNYDEAKKKELNKGLDLKGGINVTLQISVKD
FT                   ILKGLANNTKSPIFNKALADADTASKSSDDNYVDLFFDAFDNIKGDSKLASPEVFANKG
FT                   LSDEVNFQMTDDEVKPIIRRKIDESIVSAFEVLRERIDGFGVTQPNIQREGNSGRILVE
FT                   LPGARDIARAQELLSSTAQLEFWETYEQNNPSFGSFIVAANERLKSIVKTDDAIEEPVK
FT                   EESELDSLLSDATDSLDLASQVNPLYDILLPANPGTNAMFRAAIKDTATVGAYLRMPEI
FT                   QRLLPADIQFTKFLWERPSADNVEVLDLYALKSNRSSTPRIAGDVVSDARDTYDQFSKP
FT                   AVSMSMNSRGAKEWQKLTSDANVNNTGIAVVLDNKVYTAPGCSVVGGISGGGTEITGSF
FT                   TVDETKDIANVLRAGKLPAKAEIIQSNVVGPSLGQEAIDSGFMSFLIAMAIVLVWMVFY
FT                   YGKAGIFADIALLLNILLIFGVLTSLSAVLTLPGIAGIVLTIGMSVDANVLIFERIKEE
FT                   LAKGKGKSQAVSDGFGNALSSILDANITTGLTALILFLFGSGPIKGFATTLLIGILTSL
FT                   FTAIFITRLLVDWYLSGKGRTLDFSTPLTKNLFKNISINFLSKRKIAYVISFILVGIGL
FT                   FSLFFGPGLQQGVDFIGGRSYQVRFEKEVSASEIASELNTVFGSGTNVKIYGENNQIKI
FT                   TTPYKVDVEGVEVDNEIQDKLYTSLQKYLPDGTTKANFIVGSDDRAIGIMQSVKVGPTI
FT                   ADDIKNNAFLAIIGSLAVVFLYILLRFRKWQFSLGAVTAVFHDVLIVLGIFSITGKIMP
FT                   FNMEIDQAFIAAILTVIGYSLNDTVVVFDRIREIVGERGWKGGDNINSAVNSTLGRTLN
FT                   TSLTTLVVLLAIFIFGGESLRGFMFAMIVGVIVGTYSSVFIATPVMFDTLKKKILNDKE
FT                   E"
     MQNKGLIKLF AFLFGLVSIY QLSYTFITGK IEKDAEVYAS NQITEAEENY VSKREALEVR        60
     YLDSIGGNPI LGYTNYDEAK KKELNKGLDL KGGINVTLQI SVKDILKGLA NNTKSPIFNK       120
     ALADADTASK SSDDNYVDLF FDAFDNIKGD SKLASPEVFA NKGLSDEVNF QMTDDEVKPI       180
     IRRKIDESIV SAFEVLRERI DGFGVTQPNI QREGNSGRIL VELPGARDIA RAQELLSSTA       240
     QLEFWETYEQ NNPSFGSFIV AANERLKSIV KTDDAIEEPV KEESELDSLL SDATDSLDLA       300
     SQVNPLYDIL LPANPGTNAM FRAAIKDTAT VGAYLRMPEI QRLLPADIQF TKFLWERPSA       360
     DNVEVLDLYA LKSNRSSTPR IAGDVVSDAR DTYDQFSKPA VSMSMNSRGA KEWQKLTSDA       420
     NVNNTGIAVV LDNKVYTAPG CSVVGGISGG GTEITGSFTV DETKDIANVL RAGKLPAKAE       480
     IIQSNVVGPS LGQEAIDSGF MSFLIAMAIV LVWMVFYYGK AGIFADIALL LNILLIFGVL       540
     TSLSAVLTLP GIAGIVLTIG MSVDANVLIF ERIKEELAKG KGKSQAVSDG FGNALSSILD       600
     ANITTGLTAL ILFLFGSGPI KGFATTLLIG ILTSLFTAIF ITRLLVDWYL SGKGRTLDFS       660
     TPLTKNLFKN ISINFLSKRK IAYVISFILV GIGLFSLFFG PGLQQGVDFI GGRSYQVRFE       720
     KEVSASEIAS ELNTVFGSGT NVKIYGENNQ IKITTPYKVD VEGVEVDNEI QDKLYTSLQK       780
     YLPDGTTKAN FIVGSDDRAI GIMQSVKVGP TIADDIKNNA FLAIIGSLAV VFLYILLRFR       840
     KWQFSLGAVT AVFHDVLIVL GIFSITGKIM PFNMEIDQAF IAAILTVIGY SLNDTVVVFD       900
     RIREIVGERG WKGGDNINSA VNSTLGRTLN TSLTTLVVLL AIFIFGGESL RGFMFAMIVG       960
     VIVGTYSSVF IATPVMFDTL KKKILNDKEE                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page