(data stored in ACNUC7421 zone)

EMBL: CP002157.PE62

CP002157.PE62        Location/Qualifiers
FT   CDS             complement(73923..74732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16441"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00691"
FT                   /db_xref="GOA:A4ATC1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC1"
FT                   /protein_id="EAR00691.1"
FT                   /translation="MQNKLIFKMENIQNMSISPEELELLNSKLGLRSLFASKNIDLEKT
FT                   LREIKYELRLRELQAELVKLQAWAIENRKKIVILFEGRDAAGKGGAIRRITAHINPRYF
FT                   RIVALNKPTEDEQGQWYFQRYVNKLPKPGKIVFFDRSWYNRAVVEPAHGFCTEEEYKIF
FT                   MSQVNDFEKMIMESNTYLIKFYFSITKEEQGKRFDDIQKSNLKRWKMTPMDERARELWD
FT                   VYTGYKEVMLKDTNSDHAPWVIIEANKKTEARIAAIEHILKTIPYNK"
     MQNKLIFKME NIQNMSISPE ELELLNSKLG LRSLFASKNI DLEKTLREIK YELRLRELQA        60
     ELVKLQAWAI ENRKKIVILF EGRDAAGKGG AIRRITAHIN PRYFRIVALN KPTEDEQGQW       120
     YFQRYVNKLP KPGKIVFFDR SWYNRAVVEP AHGFCTEEEY KIFMSQVNDF EKMIMESNTY       180
     LIKFYFSITK EEQGKRFDDI QKSNLKRWKM TPMDERAREL WDVYTGYKEV MLKDTNSDHA       240
     PWVIIEANKK TEARIAAIEH ILKTIPYNK                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page