(data stored in ACNUC7421 zone)

EMBL: CP002157.PE621

CP002157.PE621       Location/Qualifiers
FT   CDS             complement(663278..664282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01801"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99654"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWP0"
FT                   /protein_id="EAQ99654.1"
FT                   /translation="MKRIVSLFAMVCSLQAMAQSNINEILAAGLNDAEKFTTDYLSPTS
FT                   EGIMYSLSSGWYNTADAKPLGGFEISIIGNMSNFKNKDDKKAFELNTADYENLQFTDGS
FT                   TSKLVSTSLGDIEGVSVFIEDESGLVRQDLDLPSGLASEDINFVPSGFIQASVGLIKGT
FT                   ELKARFLPKINTDDFSMGMYGVGIQHEFTKHLPADKILPIAISAVIGYTHLDASYDFTN
FT                   SNVIAGQDQKLEVDINTWAFQAVVSTKLPIINFYGGLGYLSGKSTTDVLGTYVVQSGPF
FT                   QQTYVDPFSIDKDTSGITANVGTKLKLGFFRLHADYAVAEFNTLSVGVNFGFR"
     MKRIVSLFAM VCSLQAMAQS NINEILAAGL NDAEKFTTDY LSPTSEGIMY SLSSGWYNTA        60
     DAKPLGGFEI SIIGNMSNFK NKDDKKAFEL NTADYENLQF TDGSTSKLVS TSLGDIEGVS       120
     VFIEDESGLV RQDLDLPSGL ASEDINFVPS GFIQASVGLI KGTELKARFL PKINTDDFSM       180
     GMYGVGIQHE FTKHLPADKI LPIAISAVIG YTHLDASYDF TNSNVIAGQD QKLEVDINTW       240
     AFQAVVSTKL PIINFYGGLG YLSGKSTTDV LGTYVVQSGP FQQTYVDPFS IDKDTSGITA       300
     NVGTKLKLGF FRLHADYAVA EFNTLSVGVN FGFR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page