(data stored in ACNUC7421 zone)

EMBL: CP002157.PE632

CP002157.PE632       Location/Qualifiers
FT   CDS             678480..679271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01866"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01866"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99667"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ3"
FT                   /protein_id="EAQ99667.1"
FT                   /translation="MKINSFFKTLTLALFLLGTVTIIHAQNQQKEYYQLQTYTLANEKQ
FT                   ESMTDAYLKNAYLPALKRMGIQNVGVFKMHSNNYVLSNKIYVLIPFSSLDKLYGLEQDL
FT                   HKDELYNESGKEYILASYKQPPYERLNSTILLAFDDMPKMAPSKVEGSRKDRIYELRSY
FT                   ESPTKTIFKNKVDMFNAGGEVTLFEELGFNAVFYAEVLSGDKMPNLMYMTTFTNKESRD
FT                   KHWDAFRVAPKWKELSSMSKYQNNVSHIDITFLYPTEYSDY"
     MKINSFFKTL TLALFLLGTV TIIHAQNQQK EYYQLQTYTL ANEKQESMTD AYLKNAYLPA        60
     LKRMGIQNVG VFKMHSNNYV LSNKIYVLIP FSSLDKLYGL EQDLHKDELY NESGKEYILA       120
     SYKQPPYERL NSTILLAFDD MPKMAPSKVE GSRKDRIYEL RSYESPTKTI FKNKVDMFNA       180
     GGEVTLFEEL GFNAVFYAEV LSGDKMPNLM YMTTFTNKES RDKHWDAFRV APKWKELSSM       240
     SKYQNNVSHI DITFLYPTEY SDY                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page