(data stored in ACNUC7421 zone)

EMBL: CP002157.PE634

CP002157.PE634       Location/Qualifiers
FT   CDS             complement(680566..682317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01876"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01876"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99669"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ5"
FT                   /protein_id="EAQ99669.1"
FT                   /translation="MPKHLNIFLAILGLSQLVQAQDEEKDDIGTETVTVTKAYTPTISD
FT                   AFKIKSIPNLNDSIVLQKKKIEYNIFSVPVASTFTPAKGKASAVKKMPPPELYNSYASA
FT                   GAGNPSNAMAKFYTSRAINRDERLDLGFNHNSSRATIDGVDLESKYSNTEVDASYSKRD
FT                   RDMSWGANVDLQHQLYNWYGLPAGVFDLTTIGGIDERQNYFMGELGANINVEDAYFKDA
FT                   KIKYRRFWDAVESGENRAIFGTGLEFPVGDESFGININMDYVGGSFANANVNSISNAGE
FT                   IKYSNFQVGLNPTLSMLRDDLTLNLGVNIVYGLDMENSESNFYVYPAVTASYRLLDDTV
FT                   IAYGGIEGELKQNSYHGFVEDNPFISPTLDIQPTDSQYDAYIGLKGQLLPNLSYNIKGS
FT                   YTAENRSPLFKLNPQNSFRNDEKGYYFGNSFEVFYDDIKTLGLFGELNIDVNRNFTLGI
FT                   NAEVYEYDTETNNPAWNLPNLKGSLFMDYQINEQWYMGVNLFYIGEREDFSTIVVQNPP
FT                   PTGIDATRIILDSYFDANAHVGYRVNDQLSIFVKAANIANNNYQKWANYPVQGFQILGG
FT                   ATYKFDF"
     MPKHLNIFLA ILGLSQLVQA QDEEKDDIGT ETVTVTKAYT PTISDAFKIK SIPNLNDSIV        60
     LQKKKIEYNI FSVPVASTFT PAKGKASAVK KMPPPELYNS YASAGAGNPS NAMAKFYTSR       120
     AINRDERLDL GFNHNSSRAT IDGVDLESKY SNTEVDASYS KRDRDMSWGA NVDLQHQLYN       180
     WYGLPAGVFD LTTIGGIDER QNYFMGELGA NINVEDAYFK DAKIKYRRFW DAVESGENRA       240
     IFGTGLEFPV GDESFGININ MDYVGGSFAN ANVNSISNAG EIKYSNFQVG LNPTLSMLRD       300
     DLTLNLGVNI VYGLDMENSE SNFYVYPAVT ASYRLLDDTV IAYGGIEGEL KQNSYHGFVE       360
     DNPFISPTLD IQPTDSQYDA YIGLKGQLLP NLSYNIKGSY TAENRSPLFK LNPQNSFRND       420
     EKGYYFGNSF EVFYDDIKTL GLFGELNIDV NRNFTLGINA EVYEYDTETN NPAWNLPNLK       480
     GSLFMDYQIN EQWYMGVNLF YIGEREDFST IVVQNPPPTG IDATRIILDS YFDANAHVGY       540
     RVNDQLSIFV KAANIANNNY QKWANYPVQG FQILGGATYK FDF                         583
//

If you have problems or comments...

PBIL Back to PBIL home page