(data stored in ACNUC7421 zone)

EMBL: CP002157.PE635

CP002157.PE635       Location/Qualifiers
FT   CDS             complement(682339..685362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01881"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99670"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ6"
FT                   /protein_id="EAQ99670.1"
FT                   /translation="MLRRITAFIPIFMGIIWIGAAQETKIYTHEQKDYQDALALYNNEQ
FT                   YQAAQTIFEKVKLTTKDYETEANSAYYAANAAVRLNQLGADRLMEDFVERYPTSTKRNS
FT                   AYSDVADYYFETGKYPYALKWYNKVDQSAMSRNEMDKFNFNYGYSLFSSKKTKQAERYL
FT                   SKVTNSAVYGSQAKYYLGYIAYQQDDYEGANERFDQITDPELLDEKLSYYQADMNFKLG
FT                   KFDEAIALAKKQLPKSDRREVSELNKIIGESYFNLKQYANAIPYLEAYKGKRGKWSNTD
FT                   YYLLGYCFYKQGDFVNAIQQFNKIIGGTNSVSQNAYYHLAECYLKLDKKQEALNAFRNA
FT                   SQMDFSDKIQKDAYLNYARLSYEIGNAYEPVPQVISSYLQQYPNDTHAQEMQELLVDSY
FT                   ITSKNFEGAMELLEKNRNYASKTTYQKVAFYRGVELFIDGDYAGANESFAKSLGSAEDA
FT                   LFKARANYWNAEAVYMLNRFEEALASYSDFKQNSAARLTEEYKDVDYNLAYAHFKLRDY
FT                   GSAIGYFNSFSKSGTTDQAKLNDSYLRLGDSYFVTSKYWPALETYNKALALSGPEKDYA
FT                   AFQKALSYGFVGKSASKIEELDKFVSRYPKSTLKDDALFELGNSYISAGQENKGLIAYD
FT                   RLIQGYRGSSLVPQAIMRQGLVHYNSNRNEKALGKFKTVVRDFPNTQEAIQAVATAKLV
FT                   YVDLGRVDEYAAWVRDLDFVEVTDTELDNASFESADKQNLEGNTNAAIKGYESYIKQFP
FT                   NGLHAVKANFNLAQLYFGKNQKENALPYYKYVADLGASEYTEQALTRVCEIYVGGKDYD
FT                   TALPYLLRLEEQADIQQNRTFAQSNLMKGFYEQRNYSQTIAYAEKVLATPTIDNRIKSD
FT                   AQIMIARSAIETNDENRAESAYAEVLKIATGETAAEALYYDAYFKNKVGQHESSNVSVQ
FT                   KLAKDFSSYKEWGGKGLVLMAKNFYALDDAYQATYILESVITNFSQYPEIVAEAQGELA
FT                   IIKSKEAQSNSSINPDGN"
     MLRRITAFIP IFMGIIWIGA AQETKIYTHE QKDYQDALAL YNNEQYQAAQ TIFEKVKLTT        60
     KDYETEANSA YYAANAAVRL NQLGADRLME DFVERYPTST KRNSAYSDVA DYYFETGKYP       120
     YALKWYNKVD QSAMSRNEMD KFNFNYGYSL FSSKKTKQAE RYLSKVTNSA VYGSQAKYYL       180
     GYIAYQQDDY EGANERFDQI TDPELLDEKL SYYQADMNFK LGKFDEAIAL AKKQLPKSDR       240
     REVSELNKII GESYFNLKQY ANAIPYLEAY KGKRGKWSNT DYYLLGYCFY KQGDFVNAIQ       300
     QFNKIIGGTN SVSQNAYYHL AECYLKLDKK QEALNAFRNA SQMDFSDKIQ KDAYLNYARL       360
     SYEIGNAYEP VPQVISSYLQ QYPNDTHAQE MQELLVDSYI TSKNFEGAME LLEKNRNYAS       420
     KTTYQKVAFY RGVELFIDGD YAGANESFAK SLGSAEDALF KARANYWNAE AVYMLNRFEE       480
     ALASYSDFKQ NSAARLTEEY KDVDYNLAYA HFKLRDYGSA IGYFNSFSKS GTTDQAKLND       540
     SYLRLGDSYF VTSKYWPALE TYNKALALSG PEKDYAAFQK ALSYGFVGKS ASKIEELDKF       600
     VSRYPKSTLK DDALFELGNS YISAGQENKG LIAYDRLIQG YRGSSLVPQA IMRQGLVHYN       660
     SNRNEKALGK FKTVVRDFPN TQEAIQAVAT AKLVYVDLGR VDEYAAWVRD LDFVEVTDTE       720
     LDNASFESAD KQNLEGNTNA AIKGYESYIK QFPNGLHAVK ANFNLAQLYF GKNQKENALP       780
     YYKYVADLGA SEYTEQALTR VCEIYVGGKD YDTALPYLLR LEEQADIQQN RTFAQSNLMK       840
     GFYEQRNYSQ TIAYAEKVLA TPTIDNRIKS DAQIMIARSA IETNDENRAE SAYAEVLKIA       900
     TGETAAEALY YDAYFKNKVG QHESSNVSVQ KLAKDFSSYK EWGGKGLVLM AKNFYALDDA       960
     YQATYILESV ITNFSQYPEI VAEAQGELAI IKSKEAQSNS SINPDGN                    1007
//

If you have problems or comments...

PBIL Back to PBIL home page