(data stored in ACNUC7421 zone)

EMBL: CP002157.PE637

CP002157.PE637       Location/Qualifiers
FT   CDS             complement(686324..687511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01891"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01891"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99672"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ8"
FT                   /protein_id="EAQ99672.1"
FT                   /translation="MNKVATGLEVLVNDSALQQKFKGNIALLCHNASIDANYTHAATEF
FT                   KNMFGSRFTKLFGPQHGFSTDAQDNMIETDHFVHPYFEIPVYSLYSETRIPTDEMLERI
FT                   DHLFVDLQDVGCRMYTYIYTLTLLLDKCADKEIEVIVLDRPNPLNGIDFEGNMLDVDYA
FT                   SFIGLHPIPVRHGMTIGEVGLMHQKYWAKTTANYRVIRMENWERSMFFEDTGLPWLLPS
FT                   PNLARPESAYTFPGMVLFEGTELSEGRGTTQSLEIVGHPKIEPFSFYENHLKDVLKKEK
FT                   PAGLAFRPITFLPTFQKQANAVCGGLQIHITDKANFKPWKGGQLIMRELYHYLGEDFKW
FT                   KQPPYEYDYTHMPIDIINGTDKLRHWVENNGDFEELDSFENFNSHQIQLEEIKIY"
     MNKVATGLEV LVNDSALQQK FKGNIALLCH NASIDANYTH AATEFKNMFG SRFTKLFGPQ        60
     HGFSTDAQDN MIETDHFVHP YFEIPVYSLY SETRIPTDEM LERIDHLFVD LQDVGCRMYT       120
     YIYTLTLLLD KCADKEIEVI VLDRPNPLNG IDFEGNMLDV DYASFIGLHP IPVRHGMTIG       180
     EVGLMHQKYW AKTTANYRVI RMENWERSMF FEDTGLPWLL PSPNLARPES AYTFPGMVLF       240
     EGTELSEGRG TTQSLEIVGH PKIEPFSFYE NHLKDVLKKE KPAGLAFRPI TFLPTFQKQA       300
     NAVCGGLQIH ITDKANFKPW KGGQLIMREL YHYLGEDFKW KQPPYEYDYT HMPIDIINGT       360
     DKLRHWVENN GDFEELDSFE NFNSHQIQLE EIKIY                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page