(data stored in ACNUC7421 zone)

EMBL: CP002157.PE638

CP002157.PE638       Location/Qualifiers
FT   CDS             687739..689244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01896"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01896"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99673"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWQ9"
FT                   /protein_id="EAQ99673.1"
FT                   /translation="MPQFEYEGFKYANYPFAHLYKDDNGHKGEKKIHQIIFGDWVGVLK
FT                   PKKTDGDYVLVRVRGENGWMHKDALLDERVLEIVFMDVGQGDGALIVTPDDEHIIVDAG
FT                   LGDNMWRFLKWRYNEFKTEWTFKYAIASHPDQDHYGGYHYLAGEPNVFFENYLHNGLLE
FT                   YQKDVKSSYFGDSVITDRTYYTELFDSKQKVFDFLIHEPNWKHPTGREQWDKKYAKLLK
FT                   RMLDNNKIKGEIKMVTEGDKYLKGFEQHKPLNIQILGPITEDIGGQKALRSLGNKGKTK
FT                   NGHSIVFKLNYKDINIFLGGDLNIKAEEFLLKEHTGETLEFNSAIEENEFIESARNIFE
FT                   ADVSKACHHGSADFTSLFLKCLNSIATVISSGDEEQHSHPRPDTLGAIGVNGRGDRPLI
FT                   FSTELARSHREDEKKTLDEISELEIKLATATTNAKRLKLIDQIQEKNDKLKERNVTVYG
FT                   SINLRTDGERCIIAQKLEKGGGSKVWDIYKLEKNSLGRFKYVP"
     MPQFEYEGFK YANYPFAHLY KDDNGHKGEK KIHQIIFGDW VGVLKPKKTD GDYVLVRVRG        60
     ENGWMHKDAL LDERVLEIVF MDVGQGDGAL IVTPDDEHII VDAGLGDNMW RFLKWRYNEF       120
     KTEWTFKYAI ASHPDQDHYG GYHYLAGEPN VFFENYLHNG LLEYQKDVKS SYFGDSVITD       180
     RTYYTELFDS KQKVFDFLIH EPNWKHPTGR EQWDKKYAKL LKRMLDNNKI KGEIKMVTEG       240
     DKYLKGFEQH KPLNIQILGP ITEDIGGQKA LRSLGNKGKT KNGHSIVFKL NYKDINIFLG       300
     GDLNIKAEEF LLKEHTGETL EFNSAIEENE FIESARNIFE ADVSKACHHG SADFTSLFLK       360
     CLNSIATVIS SGDEEQHSHP RPDTLGAIGV NGRGDRPLIF STELARSHRE DEKKTLDEIS       420
     ELEIKLATAT TNAKRLKLID QIQEKNDKLK ERNVTVYGSI NLRTDGERCI IAQKLEKGGG       480
     SKVWDIYKLE KNSLGRFKYV P                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page