(data stored in ACNUC7421 zone)

EMBL: CP002157.PE639

CP002157.PE639       Location/Qualifiers
FT   CDS             689250..689672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01901"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99674"
FT                   /db_xref="GOA:A4AWR0"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR0"
FT                   /protein_id="EAQ99674.1"
FT                   /translation="MIHKKQKSQSSKKVNPFIGLLLFIISIFLVVFTGPLGFIYGVFHA
FT                   LFTKGFSGVGEFFLKLAISIDQLGNVVMQHLLNLLWVKKGGYRFGNRDETISSALGKNK
FT                   QENTLTGFGKVVDRLLDIIDNNHSLNSIDYHVEPND"
     MIHKKQKSQS SKKVNPFIGL LLFIISIFLV VFTGPLGFIY GVFHALFTKG FSGVGEFFLK        60
     LAISIDQLGN VVMQHLLNLL WVKKGGYRFG NRDETISSAL GKNKQENTLT GFGKVVDRLL       120
     DIIDNNHSLN SIDYHVEPND                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page