(data stored in ACNUC7421 zone)

EMBL: CP002157.PE641

CP002157.PE641       Location/Qualifiers
FT   CDS             complement(690562..692289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01911"
FT                   /product="GTP-binding elongation factor family protein
FT                   TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01911"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99676"
FT                   /db_xref="GOA:A4AWR2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR2"
FT                   /protein_id="EAQ99676.1"
FT                   /translation="MHHCELFRENEKTGELILDNNDLERERGITIVSKNVSVTYKDTKI
FT                   NIIDTPGHADFGGEVERVLNMADGVLLLVDAFEGPMPQTRFVLQKAIDLGLKPCVVINK
FT                   VDKENCTPEEVHEKVFDLMFELGAEEWQLDFPTVYGSAKHNWMSEDWQNETDSIEPLLE
FT                   MVIEHVPSFHAQEGNTQMLITSLDFSSFTGRIAIGRLQRGSLKEGQQVSLVKRDGSIVK
FT                   SKIKELFTFEGLGRIKVKEVATGDICAIIGLEGFDIGDTIADLENPEGLKTIAIDEPTM
FT                   SMLFTINDSPFFGQDGKFVTSRHIKERLEKELEKNLALRVEETDSADKFMVFGRGVLHL
FT                   SVLIETMRREGYELQIGQPQVIIREFDGVKCEPIEHLTIDLPEEVSGKAVEMVSIRKGE
FT                   MTSMEAKGNRMLCEFIIPSRGIIGLRNQLLTATAGEAIMAHRFFEYQPLKGNIPQRQNG
FT                   SLVSMEKGKAIPYSIDKLQDRGKFFVDPGEDIYEGQVIGENSRGDDMTINITKTKKLSN
FT                   VRSAGADDKAKIVPAIKFSLEEALEYIQKDEYVEVTPKFLRLRKIYLTEVDRKRNKIA"
     MHHCELFREN EKTGELILDN NDLERERGIT IVSKNVSVTY KDTKINIIDT PGHADFGGEV        60
     ERVLNMADGV LLLVDAFEGP MPQTRFVLQK AIDLGLKPCV VINKVDKENC TPEEVHEKVF       120
     DLMFELGAEE WQLDFPTVYG SAKHNWMSED WQNETDSIEP LLEMVIEHVP SFHAQEGNTQ       180
     MLITSLDFSS FTGRIAIGRL QRGSLKEGQQ VSLVKRDGSI VKSKIKELFT FEGLGRIKVK       240
     EVATGDICAI IGLEGFDIGD TIADLENPEG LKTIAIDEPT MSMLFTINDS PFFGQDGKFV       300
     TSRHIKERLE KELEKNLALR VEETDSADKF MVFGRGVLHL SVLIETMRRE GYELQIGQPQ       360
     VIIREFDGVK CEPIEHLTID LPEEVSGKAV EMVSIRKGEM TSMEAKGNRM LCEFIIPSRG       420
     IIGLRNQLLT ATAGEAIMAH RFFEYQPLKG NIPQRQNGSL VSMEKGKAIP YSIDKLQDRG       480
     KFFVDPGEDI YEGQVIGENS RGDDMTINIT KTKKLSNVRS AGADDKAKIV PAIKFSLEEA       540
     LEYIQKDEYV EVTPKFLRLR KIYLTEVDRK RNKIA                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page