(data stored in ACNUC7421 zone)

EMBL: CP002157.PE643

CP002157.PE643       Location/Qualifiers
FT   CDS             complement(693362..693523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01921"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99678"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR4"
FT                   /protein_id="EAQ99678.1"
FT                   /translation="MLGFLGWGFLGFSLQDETKKTVISSMEITNIFFLYILKEPPRLED
FT                   LVPIRFDI"
     MLGFLGWGFL GFSLQDETKK TVISSMEITN IFFLYILKEP PRLEDLVPIR FDI               53
//

If you have problems or comments...

PBIL Back to PBIL home page