(data stored in ACNUC7421 zone)

EMBL: CP002157.PE646

CP002157.PE646       Location/Qualifiers
FT   CDS             696538..697677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01936"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01936"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99681"
FT                   /db_xref="GOA:A4AWR7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR032165"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR7"
FT                   /protein_id="EAQ99681.1"
FT                   /translation="MNLNKPNNMKKTALTILLLFSFSLVFTQSHSHLSNKAFTYPNIEG
FT                   YVTLKADLHIHTVFSDGNVWPTIRVQEALRENLDAISLTEHIEYQPHKDDIPHPDRNRA
FT                   YHLAFAEAKDHDLLIIPGSEITRSEPVGHNNAVFINDANKLMGSNPESPFKEAKKQNAF
FT                   VFWNHPAWHAQSPTGNPIMSDFQKERIKNGELHGIEVINAMDYAEESLALALEYDLTIM
FT                   GTSDIHGLIDWDYTEKGNHRPITLVFAKEKSLKSMKEALFEGRTVAVYNDLLVGKPEYL
FT                   NPLLKESIVIESAKYLSKTNVLKVELKNISSSDLLFENQMDFNFYDSSPVFEVEAGRTK
FT                   TVHIKTIEKLTSVQLKLKALGAFTAPKQQPVVEWKIVVD"
     MNLNKPNNMK KTALTILLLF SFSLVFTQSH SHLSNKAFTY PNIEGYVTLK ADLHIHTVFS        60
     DGNVWPTIRV QEALRENLDA ISLTEHIEYQ PHKDDIPHPD RNRAYHLAFA EAKDHDLLII       120
     PGSEITRSEP VGHNNAVFIN DANKLMGSNP ESPFKEAKKQ NAFVFWNHPA WHAQSPTGNP       180
     IMSDFQKERI KNGELHGIEV INAMDYAEES LALALEYDLT IMGTSDIHGL IDWDYTEKGN       240
     HRPITLVFAK EKSLKSMKEA LFEGRTVAVY NDLLVGKPEY LNPLLKESIV IESAKYLSKT       300
     NVLKVELKNI SSSDLLFENQ MDFNFYDSSP VFEVEAGRTK TVHIKTIEKL TSVQLKLKAL       360
     GAFTAPKQQP VVEWKIVVD                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page