(data stored in ACNUC7421 zone)

EMBL: CP002157.PE648

CP002157.PE648       Location/Qualifiers
FT   CDS             699224..699832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01946"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01946"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99683"
FT                   /db_xref="GOA:A4AWR9"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWR9"
FT                   /protein_id="EAQ99683.1"
FT                   /translation="MESKNYLKDLSEIKDLMSKSSRFISLSGLSGVLAGIYALIGATIT
FT                   YWLVTTYSNGTLLLDGWIFRTSLLILCCVAGLSILTGIYLTTRKAKKNGEKIWDASSKR
FT                   LIVNFMIPMITGGLYIIIILSQQKYGQAGALMLIFYGLALINAAKYSIGNIRYLGYIEI
FT                   ILGLICALVPGYGFWLWVFGFGIMHIIYGSVMYFKYEKK"
     MESKNYLKDL SEIKDLMSKS SRFISLSGLS GVLAGIYALI GATITYWLVT TYSNGTLLLD        60
     GWIFRTSLLI LCCVAGLSIL TGIYLTTRKA KKNGEKIWDA SSKRLIVNFM IPMITGGLYI       120
     IIILSQQKYG QAGALMLIFY GLALINAAKY SIGNIRYLGY IEIILGLICA LVPGYGFWLW       180
     VFGFGIMHII YGSVMYFKYE KK                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page