(data stored in ACNUC7421 zone)

EMBL: CP002157.PE65

CP002157.PE65        Location/Qualifiers
FT   CDS             complement(76367..76576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16456"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00694"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATC4"
FT                   /protein_id="EAR00694.1"
FT                   /translation="MKKSLIEKIVQVCDAKIKAKGENVGLSFYAFFSNKNDNPELLMEM
FT                   AQWWILENKLDHFEKAVKIKAMVA"
     MKKSLIEKIV QVCDAKIKAK GENVGLSFYA FFSNKNDNPE LLMEMAQWWI LENKLDHFEK        60
     AVKIKAMVA                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page