(data stored in ACNUC7421 zone)

EMBL: CP002157.PE654

CP002157.PE654       Location/Qualifiers
FT   CDS             707393..708973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01985"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02014"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ2"
FT                   /protein_id="EAR02014.1"
FT                   /translation="MNMEKDYFLLKDKIKEIESKFFINNGWLKIYENDSKGLDDSSGIY
FT                   CCLVSNNQFELYNKDYKWPLSMGREGKPSVYGDNAYKTYDEEGLEPFLFYKQFSLTESS
FT                   VKYIDISEEFILYFRLYEKGSDKQNRTFFYVNDYGELDEVITIEPHLIKIQIKYLKEYI
FT                   TMRDMNFVVCYDFMRLVSNIPSEWNIKYGEKLINDNEFIYSHLIRNVSDKIQSWIMGKV
FT                   LIKPNKVKKTHFDLGESKNEEFIIGYDDEGELLYENCGKTDGNHFKATYFKKEVLNKYY
FT                   NEPYKYEVDGFGVSSKFFSLKIDNNVGDYVPVFLTNLRTLPHKEQLHWKQYNIPPKENM
FT                   NISRTYYRTMIDGQWAEQPETADLFFKSKYKEFNKKWEKKFGWNLYKPLSELDKYLFTS
FT                   LHKITSNNIKAFCEQTLTIVKLTIDRLNEKELAKGLNLDSNVRGILKFEKFLESKEMKI
FT                   PDMFEFLRNLQNLRSGLIAHSFSESNSDCKKALKYFKIEDDNYMEVLEEIFIKSVHTFN
FT                   TLEEYFKLK"
     MNMEKDYFLL KDKIKEIESK FFINNGWLKI YENDSKGLDD SSGIYCCLVS NNQFELYNKD        60
     YKWPLSMGRE GKPSVYGDNA YKTYDEEGLE PFLFYKQFSL TESSVKYIDI SEEFILYFRL       120
     YEKGSDKQNR TFFYVNDYGE LDEVITIEPH LIKIQIKYLK EYITMRDMNF VVCYDFMRLV       180
     SNIPSEWNIK YGEKLINDNE FIYSHLIRNV SDKIQSWIMG KVLIKPNKVK KTHFDLGESK       240
     NEEFIIGYDD EGELLYENCG KTDGNHFKAT YFKKEVLNKY YNEPYKYEVD GFGVSSKFFS       300
     LKIDNNVGDY VPVFLTNLRT LPHKEQLHWK QYNIPPKENM NISRTYYRTM IDGQWAEQPE       360
     TADLFFKSKY KEFNKKWEKK FGWNLYKPLS ELDKYLFTSL HKITSNNIKA FCEQTLTIVK       420
     LTIDRLNEKE LAKGLNLDSN VRGILKFEKF LESKEMKIPD MFEFLRNLQN LRSGLIAHSF       480
     SESNSDCKKA LKYFKIEDDN YMEVLEEIFI KSVHTFNTLE EYFKLK                      526
//

If you have problems or comments...

PBIL Back to PBIL home page