(data stored in ACNUC7421 zone)

EMBL: CP002157.PE655

CP002157.PE655       Location/Qualifiers
FT   CDS             709000..710061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01990"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02015"
FT                   /db_xref="InterPro:IPR025935"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ3"
FT                   /protein_id="EAR02015.1"
FT                   /translation="MINEKAKLTTNLKSKTKNSKTLYIIGNGFDLHHGLKTGYNDFGEY
FT                   LLDNDKELFELLEKYIAFTIKGDTPTEDDNLWGDFEENLAHLDIDGIIDDNNVYLPDWS
FT                   SDDFRAGDLHAFPNTMMEICGKLTSDLIQNFEDFILRTVYKESVSERLIELNKNAKYLS
FT                   FNYTNTLERLYDIPKEKILYIHNSAFHGSGDIILGHGIKPENFRNDPTPPDGLTEEEMD
FT                   RWVEEQNDNYDYSFDEGMEQLYRYFTDTYKPTDTIIKANEDFFKKLADIEQIYIFGLSF
FT                   SSVDLPYLIEIVKNLSVKVKWTVSYRSANKVAEVKKTLEGIGIKDINFIKLDELLIDNK
FT                   QLKLDLFPNEKTA"
     MINEKAKLTT NLKSKTKNSK TLYIIGNGFD LHHGLKTGYN DFGEYLLDND KELFELLEKY        60
     IAFTIKGDTP TEDDNLWGDF EENLAHLDID GIIDDNNVYL PDWSSDDFRA GDLHAFPNTM       120
     MEICGKLTSD LIQNFEDFIL RTVYKESVSE RLIELNKNAK YLSFNYTNTL ERLYDIPKEK       180
     ILYIHNSAFH GSGDIILGHG IKPENFRNDP TPPDGLTEEE MDRWVEEQND NYDYSFDEGM       240
     EQLYRYFTDT YKPTDTIIKA NEDFFKKLAD IEQIYIFGLS FSSVDLPYLI EIVKNLSVKV       300
     KWTVSYRSAN KVAEVKKTLE GIGIKDINFI KLDELLIDNK QLKLDLFPNE KTA              353
//

If you have problems or comments...

PBIL Back to PBIL home page