(data stored in ACNUC7421 zone)

EMBL: CP002157.PE657

CP002157.PE657       Location/Qualifiers
FT   CDS             712191..714638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02000"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02000"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02017"
FT                   /db_xref="GOA:A4ALZ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ5"
FT                   /protein_id="EAR02017.1"
FT                   /translation="MNEAQTKHDLIEPALREAGWGIVKGSRLRLEFPITKGRLIGQNRR
FT                   SKPLFADYVLEYKNRRIGIVEAKKRDLYYTDGVGQAKDYAERLNIRFTYATNGLQIYGI
FT                   DLEECTEGDVSKYPTPDELWEMTYPTPKEDYKVEIANWKERLFAIPFEDRGGTWQPRYY
FT                   QQNAIAKVLEAISEKKDRILLTLATGTGKTAIAFQIAWKLFHAKWNLRRDASRSPRILF
FT                   LADRNILADQAFNSFNAFDTIDENIKVRIRPSEIKKKGTVPTNGSVFFTIFQTFMTDAQ
FT                   KNVDLEEVSEDVIPEIKKPEDFNFGQYPPDFFDLIVIDECHRGGGNDESSWRAIMDYFS
FT                   PAVQLGLTATPKRDVNGDTYNYFGDPVYTYKLKDGINDGFLTPFKVKEIQTNYDEYTVT
FT                   EDDTIIFGEAEVGDTFTYRDYGRKIIIQQVEEYRVKKFLEIINQNQKSLVFCATQKHAA
FT                   LIRDLINQNTDSKSTNYCHRVTADDGKMGELHLRDFQDNEKSIPTILTTSQKLSTGVDA
FT                   PEIRNIVLLRPVDSMVEFKQIVGRGTRLFDSKDYFTLFDFVNAHNHFQDPEWDGEPIPP
FT                   EPSTGGGTPRVCNICGETPCVCERPEPEPCPECDNIPCVCETPPRRMIKVKLSDNKVRE
FT                   IDSMVKTSFWSPSGKPISSQEFIEQLFGDLPSFFASENELRKIWSLPSTRKKLLNELSE
FT                   KGYTNSQLEDLRNLIHGEESDLFDVLSYVAYHKDLVPRLERAGKAKIQMNDYNPKQQEF
FT                   LNFVLEQYVKEGVDELDDAKLPNLLELKYQAIADAKNELGAIKSIRDTFIGFQELLYRD
FT                   RAM"
     MNEAQTKHDL IEPALREAGW GIVKGSRLRL EFPITKGRLI GQNRRSKPLF ADYVLEYKNR        60
     RIGIVEAKKR DLYYTDGVGQ AKDYAERLNI RFTYATNGLQ IYGIDLEECT EGDVSKYPTP       120
     DELWEMTYPT PKEDYKVEIA NWKERLFAIP FEDRGGTWQP RYYQQNAIAK VLEAISEKKD       180
     RILLTLATGT GKTAIAFQIA WKLFHAKWNL RRDASRSPRI LFLADRNILA DQAFNSFNAF       240
     DTIDENIKVR IRPSEIKKKG TVPTNGSVFF TIFQTFMTDA QKNVDLEEVS EDVIPEIKKP       300
     EDFNFGQYPP DFFDLIVIDE CHRGGGNDES SWRAIMDYFS PAVQLGLTAT PKRDVNGDTY       360
     NYFGDPVYTY KLKDGINDGF LTPFKVKEIQ TNYDEYTVTE DDTIIFGEAE VGDTFTYRDY       420
     GRKIIIQQVE EYRVKKFLEI INQNQKSLVF CATQKHAALI RDLINQNTDS KSTNYCHRVT       480
     ADDGKMGELH LRDFQDNEKS IPTILTTSQK LSTGVDAPEI RNIVLLRPVD SMVEFKQIVG       540
     RGTRLFDSKD YFTLFDFVNA HNHFQDPEWD GEPIPPEPST GGGTPRVCNI CGETPCVCER       600
     PEPEPCPECD NIPCVCETPP RRMIKVKLSD NKVREIDSMV KTSFWSPSGK PISSQEFIEQ       660
     LFGDLPSFFA SENELRKIWS LPSTRKKLLN ELSEKGYTNS QLEDLRNLIH GEESDLFDVL       720
     SYVAYHKDLV PRLERAGKAK IQMNDYNPKQ QEFLNFVLEQ YVKEGVDELD DAKLPNLLEL       780
     KYQAIADAKN ELGAIKSIRD TFIGFQELLY RDRAM                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page