(data stored in ACNUC7421 zone)

EMBL: CP002157.PE658

CP002157.PE658       Location/Qualifiers
FT   CDS             complement(714711..716108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02005"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02018"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ6"
FT                   /protein_id="EAR02018.1"
FT                   /translation="MKSVIIQKPLLEDLKESIGLQNKLELDKAVYFVSLINSMPTSYRG
FT                   NEIDFMRVNLDSQKLKGVDWKAADYMRFLIKNRFIEKVRNHSSFHGKCAAYRIPEQYFH
FT                   GEIVPFRIWNKSVLEKFDQKGRDSSKSHQMDFCREQRPHLVRWFDENLSINREDAHNEI
FT                   SYYRNNDDHQKYIHSMQLISEWEDKSWTYSIKPETDNRLHTTLTRTNRSLRKHLRYQDK
FT                   GLVGLDLKTSQPYFLCAILKGLCFRDIDYLERIGATKILGMNLIQELCALVDIDEARAF
FT                   ACDVINEDLYNVLIKIIPIQYDLETGKPFRIVINGKGMKEFITKKLYESERDCMKEVVL
FT                   TVFNCKKGYSSAETKAFAAAFPSIYAIIQRIKEDEDVEFYQLLSHVEAYCLLDCVAKKI
FT                   AAKYPEMPLLSIHDSLVTTDDMKTLLQNKMEKYLFDITRLKPTIELENWTEDKGITINN
FT                   KLLITLM"
     MKSVIIQKPL LEDLKESIGL QNKLELDKAV YFVSLINSMP TSYRGNEIDF MRVNLDSQKL        60
     KGVDWKAADY MRFLIKNRFI EKVRNHSSFH GKCAAYRIPE QYFHGEIVPF RIWNKSVLEK       120
     FDQKGRDSSK SHQMDFCREQ RPHLVRWFDE NLSINREDAH NEISYYRNND DHQKYIHSMQ       180
     LISEWEDKSW TYSIKPETDN RLHTTLTRTN RSLRKHLRYQ DKGLVGLDLK TSQPYFLCAI       240
     LKGLCFRDID YLERIGATKI LGMNLIQELC ALVDIDEARA FACDVINEDL YNVLIKIIPI       300
     QYDLETGKPF RIVINGKGMK EFITKKLYES ERDCMKEVVL TVFNCKKGYS SAETKAFAAA       360
     FPSIYAIIQR IKEDEDVEFY QLLSHVEAYC LLDCVAKKIA AKYPEMPLLS IHDSLVTTDD       420
     MKTLLQNKME KYLFDITRLK PTIELENWTE DKGITINNKL LITLM                       465
//

If you have problems or comments...

PBIL Back to PBIL home page