(data stored in ACNUC7421 zone)

EMBL: CP002157.PE659

CP002157.PE659       Location/Qualifiers
FT   CDS             complement(716114..716395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02010"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02019"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4ALZ7"
FT                   /protein_id="EAR02019.1"
FT                   /translation="MSKTIQFLQVTPEELKHEILKGLSKQLEELKKGFSTNAPIDYLSR
FT                   ADVAKMLQIDLSTLYIWTKKGVLTSYGIGNRVYYKREEVEAAIIRLNQ"
     MSKTIQFLQV TPEELKHEIL KGLSKQLEEL KKGFSTNAPI DYLSRADVAK MLQIDLSTLY        60
     IWTKKGVLTS YGIGNRVYYK REEVEAAIIR LNQ                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page