(data stored in ACNUC7421 zone)

EMBL: CP002157.PE665

CP002157.PE665       Location/Qualifiers
FT   CDS             720746..721378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02040"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02025"
FT                   /db_xref="GOA:A4AM03"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM03"
FT                   /protein_id="EAR02025.1"
FT                   /translation="MKRKEVTNIIEKEKIVAIIRLKKQSEVDTVIKGLILGGIKVLEIT
FT                   SNTPGFNKEIKKARDSYPNILIGAGTVVNTSIAKIAIEAGAQFLVTPNTNIDVLTLAHE
FT                   NDVPVLMGAFTPSEICLAIEYGADIIKLFPAGNLGIDYFKAIQGPLNDAKFFIVGGINL
FT                   ENIQEWFKAGVSGVGIGSVLTNSPNEEICEETIKNKAQEFINLIKNF"
     MKRKEVTNII EKEKIVAIIR LKKQSEVDTV IKGLILGGIK VLEITSNTPG FNKEIKKARD        60
     SYPNILIGAG TVVNTSIAKI AIEAGAQFLV TPNTNIDVLT LAHENDVPVL MGAFTPSEIC       120
     LAIEYGADII KLFPAGNLGI DYFKAIQGPL NDAKFFIVGG INLENIQEWF KAGVSGVGIG       180
     SVLTNSPNEE ICEETIKNKA QEFINLIKNF                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page