(data stored in ACNUC7421 zone)

EMBL: CP002157.PE672

CP002157.PE672       Location/Qualifiers
FT   CDS             complement(727537..728745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02075"
FT                   /product="BNR repeat protein putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02075"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02032"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM10"
FT                   /protein_id="EAR02032.1"
FT                   /translation="MRFCLFALAFILFLSCKEEQKREVQLVKFVSSPTGPMSSLPSLSS
FT                   NKDITLISWVEKVNDSLTKLKYARLIGGQWKDPKLITQGEDWFVNWADFPTIAENNGNL
FT                   VSHVLKKSSKKTFSYDVRLNVMGKENSQWAADLQLHSDSTKTEHGFVTTLPYDEAFFIT
FT                   WLDGRNTSGSGHDHHGGAMTIRAAEVSSKGLISNEHVLDERTCDCCQTTAAITANGPVV
FT                   VYRDRSDDEVRDMSIVRLVNGNWTAPKTINNDNWQIKGCPVNGPKADAIDNDLVVAWFT
FT                   EANGEAKVKVTFSSDGGVNFDKPIRIGDTKAMGRVDIALIDAERAIVSWMETINQKALF
FT                   KAVKVNKNGQMGRSIVIDTMAASRKSGFPQMELVQDKIYFAWTDATGDITTVKTANVRL
FT                   DSF"
     MRFCLFALAF ILFLSCKEEQ KREVQLVKFV SSPTGPMSSL PSLSSNKDIT LISWVEKVND        60
     SLTKLKYARL IGGQWKDPKL ITQGEDWFVN WADFPTIAEN NGNLVSHVLK KSSKKTFSYD       120
     VRLNVMGKEN SQWAADLQLH SDSTKTEHGF VTTLPYDEAF FITWLDGRNT SGSGHDHHGG       180
     AMTIRAAEVS SKGLISNEHV LDERTCDCCQ TTAAITANGP VVVYRDRSDD EVRDMSIVRL       240
     VNGNWTAPKT INNDNWQIKG CPVNGPKADA IDNDLVVAWF TEANGEAKVK VTFSSDGGVN       300
     FDKPIRIGDT KAMGRVDIAL IDAERAIVSW METINQKALF KAVKVNKNGQ MGRSIVIDTM       360
     AASRKSGFPQ MELVQDKIYF AWTDATGDIT TVKTANVRLD SF                          402
//

If you have problems or comments...

PBIL Back to PBIL home page