(data stored in ACNUC7421 zone)

EMBL: CP002157.PE673

CP002157.PE673       Location/Qualifiers
FT   CDS             complement(728745..729224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_02080"
FT                   /product="thiol:disulfide interchange protein tlpA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_02080"
FT                   /db_xref="EnsemblGenomes-Tr:EAR02033"
FT                   /db_xref="GOA:A4AM11"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AM11"
FT                   /protein_id="EAR02033.1"
FT                   /translation="MGMLNSCKDADKKSTTVVRMDKSIEEAVVSSNGYEDLEGNPVDLS
FT                   DYKGKRILLNFWATWCRPCVEEMPSLLKAEEILEKENYVVLLATDQSVKIINSFKERKG
FT                   FEFTYIRYTGAFADLGIKALPKTFVYNEEGKKVDEISGALEWDSPETIERLKSLD"
     MGMLNSCKDA DKKSTTVVRM DKSIEEAVVS SNGYEDLEGN PVDLSDYKGK RILLNFWATW        60
     CRPCVEEMPS LLKAEEILEK ENYVVLLATD QSVKIINSFK ERKGFEFTYI RYTGAFADLG       120
     IKALPKTFVY NEEGKKVDEI SGALEWDSPE TIERLKSLD                              159
//

If you have problems or comments...

PBIL Back to PBIL home page