(data stored in ACNUC7421 zone)

EMBL: CP002157.PE7

CP002157.PE7         Location/Qualifiers
FT   CDS             18943..20532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16166"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16166"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00636"
FT                   /db_xref="GOA:A4AT66"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT66"
FT                   /protein_id="EAR00636.1"
FT                   /translation="MSFQNEIERRRTFGIISHPDAGKTTLTEKLLLFGGAIQEAGAVKN
FT                   NKIKKTATSDFMEIERQRGISVATSVLAFLYKDKKINILDTPGHKDFAEDTFRTLTAVD
FT                   SVIVVVDVAKGVEEQTVKLVEVCRMRNIPMIVFINKLDREGKDAFDLLDDLEQKLGLTV
FT                   TPLSFPIGMGYDFKGIYNIYEKNINLFSGDSKKNIEDTIAFDDIENSELDDIIGATSAE
FT                   SLRDDLELVSGVYPPFNKESYLKGDQQPVFFGSALNNFGVRELLDCFIEIAPSPRAKMA
FT                   EERLVEADEKKLTGFVFKIHANMDPKHRDRLAFVKIVSGTFERNKPYLHVRHGKNLKFS
FT                   SPNAFFAEKKEIVDISYPGDIVGLHDTGNFKIGDTLTEGEQLNYKGIPSFSPEHFRYIN
FT                   NADPMKSKQLGKGIDQLMDEGVAQLFILEMNGRKVIGTVGALQFEVIQYRLEHEYGAKC
FT                   SYENFPVHKACWVEPQDEKNEEFKEFKRVKQKFLAKDKRGQMVFLADSQFSLQMTQQKY
FT                   PSVILHFTSEFK"
     MSFQNEIERR RTFGIISHPD AGKTTLTEKL LLFGGAIQEA GAVKNNKIKK TATSDFMEIE        60
     RQRGISVATS VLAFLYKDKK INILDTPGHK DFAEDTFRTL TAVDSVIVVV DVAKGVEEQT       120
     VKLVEVCRMR NIPMIVFINK LDREGKDAFD LLDDLEQKLG LTVTPLSFPI GMGYDFKGIY       180
     NIYEKNINLF SGDSKKNIED TIAFDDIENS ELDDIIGATS AESLRDDLEL VSGVYPPFNK       240
     ESYLKGDQQP VFFGSALNNF GVRELLDCFI EIAPSPRAKM AEERLVEADE KKLTGFVFKI       300
     HANMDPKHRD RLAFVKIVSG TFERNKPYLH VRHGKNLKFS SPNAFFAEKK EIVDISYPGD       360
     IVGLHDTGNF KIGDTLTEGE QLNYKGIPSF SPEHFRYINN ADPMKSKQLG KGIDQLMDEG       420
     VAQLFILEMN GRKVIGTVGA LQFEVIQYRL EHEYGAKCSY ENFPVHKACW VEPQDEKNEE       480
     FKEFKRVKQK FLAKDKRGQM VFLADSQFSL QMTQQKYPSV ILHFTSEFK                   529
//

If you have problems or comments...

PBIL Back to PBIL home page