(data stored in ACNUC7421 zone)

EMBL: CP002157.PE78

CP002157.PE78        Location/Qualifiers
FT   CDS             88080..90266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16521"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16521"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00707"
FT                   /db_xref="GOA:A4ATD7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD7"
FT                   /protein_id="EAR00707.1"
FT                   /translation="MTIVIIIWCFGFSTIAQDDPNHNNVQTYFNEARTYSNKNQIDLAL
FT                   SSLDKAAALAEENKDVKTLIDSYNMFALLYLKLDKVNTTKYYWDRAKVLLGEVEYPYGD
FT                   AIYKYIEAILLYKENQNFQAIFMLGEARQLNNDRNFFNNILLVEGNIYLNLEKYESALK
FT                   NFNSLVVNTDVYEKDYLASKAYIGLARTNIKLNNFEEALSNAQSALKLADENGFYLEVV
FT                   EGNQLLSKSYEGLERFEEALVATRNLYTAKDSLFTLEKIKIETKTADEIHSENMANEIK
FT                   RQDKRIEELSKSANKSEITAILTSAFLIIISLLAVSLYRNNQIKLKTNTLLQTKNSELQ
FT                   AARDEAVNAMEAKTNFLSTVSHELRTPLYAVTGLTHLLLEENPSENQKEHLKALKFSGD
FT                   YLLNFINDILHINKIDADKLEPLNMEFNLKKVLKEVIDSLQQSAKENNTEIILDYDDTI
FT                   PSHLMSDPLKLSQIFMNLIGNALKFTKNGEVKVVAQMVHKEEEDVTLYFEVLDNGIGIS
FT                   KEQQQKIFEGFEQGSIQINREYGGTGLGLTIVKSLLGLFDSQIKLQSDLGQGSSFFFEL
FT                   KLKSKDSIVDDIPFELTQKDYTFKGLHLMIVEDNKINQVITKKMLSKKEITSDIASNGM
FT                   AAIDLAKKNKYDAILMDIHMPGISGEEATIEIRKFDQITPIIALTAISLDDSLESFYAA
FT                   GCNDVVTKPFKPEVFYQKIGENIFDNRENGSLSS"
     MTIVIIIWCF GFSTIAQDDP NHNNVQTYFN EARTYSNKNQ IDLALSSLDK AAALAEENKD        60
     VKTLIDSYNM FALLYLKLDK VNTTKYYWDR AKVLLGEVEY PYGDAIYKYI EAILLYKENQ       120
     NFQAIFMLGE ARQLNNDRNF FNNILLVEGN IYLNLEKYES ALKNFNSLVV NTDVYEKDYL       180
     ASKAYIGLAR TNIKLNNFEE ALSNAQSALK LADENGFYLE VVEGNQLLSK SYEGLERFEE       240
     ALVATRNLYT AKDSLFTLEK IKIETKTADE IHSENMANEI KRQDKRIEEL SKSANKSEIT       300
     AILTSAFLII ISLLAVSLYR NNQIKLKTNT LLQTKNSELQ AARDEAVNAM EAKTNFLSTV       360
     SHELRTPLYA VTGLTHLLLE ENPSENQKEH LKALKFSGDY LLNFINDILH INKIDADKLE       420
     PLNMEFNLKK VLKEVIDSLQ QSAKENNTEI ILDYDDTIPS HLMSDPLKLS QIFMNLIGNA       480
     LKFTKNGEVK VVAQMVHKEE EDVTLYFEVL DNGIGISKEQ QQKIFEGFEQ GSIQINREYG       540
     GTGLGLTIVK SLLGLFDSQI KLQSDLGQGS SFFFELKLKS KDSIVDDIPF ELTQKDYTFK       600
     GLHLMIVEDN KINQVITKKM LSKKEITSDI ASNGMAAIDL AKKNKYDAIL MDIHMPGISG       660
     EEATIEIRKF DQITPIIALT AISLDDSLES FYAAGCNDVV TKPFKPEVFY QKIGENIFDN       720
     RENGSLSS                                                                728
//

If you have problems or comments...

PBIL Back to PBIL home page