(data stored in ACNUC7421 zone)

EMBL: CP002157.PE79

CP002157.PE79        Location/Qualifiers
FT   CDS             complement(90256..91290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16526"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16526"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00708"
FT                   /db_xref="GOA:A4ATD8"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATD8"
FT                   /protein_id="EAR00708.1"
FT                   /translation="MLPKIKYYIFVLMQLLRKIAFPFSLIYALVVHIRNYLYDTGLFTS
FT                   KSFKTPTICVGNLSVGGTGKTPMIEYLIENLSTSFKIAVLSRGYRRKSKGYVLAGTESK
FT                   VEDIGDEPYQIHSKFPNISVAVDADRCRGIRKLQETIQPDVILLDDAFQHRKVQPQFSL
FT                   LLTSYDNLYIKDWYLPTGDLRDSKREAKRANIIIVTKCPVHLNKRIQEEIIKNLNPKQD
FT                   QQVLFCYYYYSEKLLGNNSSVSLDDFKGKRITLVTGIANPKALVDYLAGKGIDFEHLEY
FT                   KDHHFFTKQEIDLINSKEHVLTTEKDFVRLNNEVENLHYISVKHVFLDEGSSVLERSLQ
FT                   QVMS"
     MLPKIKYYIF VLMQLLRKIA FPFSLIYALV VHIRNYLYDT GLFTSKSFKT PTICVGNLSV        60
     GGTGKTPMIE YLIENLSTSF KIAVLSRGYR RKSKGYVLAG TESKVEDIGD EPYQIHSKFP       120
     NISVAVDADR CRGIRKLQET IQPDVILLDD AFQHRKVQPQ FSLLLTSYDN LYIKDWYLPT       180
     GDLRDSKREA KRANIIIVTK CPVHLNKRIQ EEIIKNLNPK QDQQVLFCYY YYSEKLLGNN       240
     SSVSLDDFKG KRITLVTGIA NPKALVDYLA GKGIDFEHLE YKDHHFFTKQ EIDLINSKEH       300
     VLTTEKDFVR LNNEVENLHY ISVKHVFLDE GSSVLERSLQ QVMS                        344
//

If you have problems or comments...

PBIL Back to PBIL home page