(data stored in ACNUC7421 zone)

EMBL: CP002157.PE83

CP002157.PE83        Location/Qualifiers
FT   CDS             complement(94851..95399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16546"
FT                   /product="Protease subunit of ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16546"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00712"
FT                   /db_xref="GOA:A4ATE2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE2"
FT                   /protein_id="EAR00712.1"
FT                   /translation="MSSKKGKVQEAIDEKLLEERKVFLWGMVDDDSAKHVIDRLLYLDM
FT                   QNNKEIQLFINSPGGYVTSGFAMYDTIKSLKSPVSTICTGLAASMGSILLSVGKKGRRF
FT                   IQPHAQVMIHQPSGGARGQASNIEIQAKEIIKTKELSAQILADNCGQDFDTVMRDFDRD
FT                   YWMNAEESIEYGIVDGVLE"
     MSSKKGKVQE AIDEKLLEER KVFLWGMVDD DSAKHVIDRL LYLDMQNNKE IQLFINSPGG        60
     YVTSGFAMYD TIKSLKSPVS TICTGLAASM GSILLSVGKK GRRFIQPHAQ VMIHQPSGGA       120
     RGQASNIEIQ AKEIIKTKEL SAQILADNCG QDFDTVMRDF DRDYWMNAEE SIEYGIVDGV       180
     LE                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page