(data stored in ACNUC7421 zone)

EMBL: CP002157.PE89

CP002157.PE89        Location/Qualifiers
FT   CDS             100232..100873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16576"
FT                   /product="O-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16576"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00718"
FT                   /db_xref="GOA:A4ATE8"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATE8"
FT                   /protein_id="EAR00718.1"
FT                   /translation="MHFLSQVLENYIENSSENEPELLKKLSRETHLKVIQPRMITGHFQ
FT                   GRVLSLLSKIINPTNILEIGTYTGYSALCLAEGLKKNGTLHTIDINEELADIQRKYFEE
FT                   SGFGHQIIQHAGDALKIIPEMNETFNLVFIDAEKREYPEYFEAVMEKTSSGSIILSDNV
FT                   LWSGKVVEPLNEKDIATKTLLGYNKKLKEDSRVETVLLPIRDGLTLSRVL"
     MHFLSQVLEN YIENSSENEP ELLKKLSRET HLKVIQPRMI TGHFQGRVLS LLSKIINPTN        60
     ILEIGTYTGY SALCLAEGLK KNGTLHTIDI NEELADIQRK YFEESGFGHQ IIQHAGDALK       120
     IIPEMNETFN LVFIDAEKRE YPEYFEAVME KTSSGSIILS DNVLWSGKVV EPLNEKDIAT       180
     KTLLGYNKKL KEDSRVETVL LPIRDGLTLS RVL                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page