(data stored in ACNUC7421 zone)

EMBL: CP002157.PE93

CP002157.PE93        Location/Qualifiers
FT   CDS             complement(104214..104729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16596"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00722"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF2"
FT                   /protein_id="EAR00722.1"
FT                   /translation="MMKMKFIKKSLLLLLLPLFAFTTAHKFYVSVTNISYSEKDKAIQI
FT                   TSRLFIDDIEKVLEERYGFKTQLATEAESKMTDSYIEKYLKTKFLVYANDNQMQYNFIG
FT                   KKYDNDVMICYLEIPEVDIEKIKSIKVQNELLTDLFDDQQNVVHFKIKGKKKSFVLIKE
FT                   NNKGMLKL"
     MMKMKFIKKS LLLLLLPLFA FTTAHKFYVS VTNISYSEKD KAIQITSRLF IDDIEKVLEE        60
     RYGFKTQLAT EAESKMTDSY IEKYLKTKFL VYANDNQMQY NFIGKKYDND VMICYLEIPE       120
     VDIEKIKSIK VQNELLTDLF DDQQNVVHFK IKGKKKSFVL IKENNKGMLK L                171
//

If you have problems or comments...

PBIL Back to PBIL home page