(data stored in ACNUC7421 zone)

EMBL: CP002157.PE95

CP002157.PE95        Location/Qualifiers
FT   CDS             complement(105600..106343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16606"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00724"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF4"
FT                   /protein_id="EAR00724.1"
FT                   /translation="MGTTLGAQSLFVKQIEGRVYSKNEDVAATHVLNITADKASITDLN
FT                   GFFSITAKLNDTLVFSAIQFKRKIVVISNEVLKSKLLYVPLEDAVNELDEVIVMPYNLT
FT                   GDMSTDLSRAEIEPVVTASTLGLPNAYVVPPTQAERKLYEATTGGGILPLNPILNGISG
FT                   RTKMLKERVARNEKYERTQRVRAFYPDSLYRIEFKIPEVNIDDFMYFCEVDTAFQVVVD
FT                   SHDRFKIWEFMRKKSVVYRKNNELD"
     MGTTLGAQSL FVKQIEGRVY SKNEDVAATH VLNITADKAS ITDLNGFFSI TAKLNDTLVF        60
     SAIQFKRKIV VISNEVLKSK LLYVPLEDAV NELDEVIVMP YNLTGDMSTD LSRAEIEPVV       120
     TASTLGLPNA YVVPPTQAER KLYEATTGGG ILPLNPILNG ISGRTKMLKE RVARNEKYER       180
     TQRVRAFYPD SLYRIEFKIP EVNIDDFMYF CEVDTAFQVV VDSHDRFKIW EFMRKKSVVY       240
     RKNNELD                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page