(data stored in ACNUC7421 zone)

EMBL: CP002157.PE98

CP002157.PE98        Location/Qualifiers
FT   CDS             110487..111635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16621"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00727"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATF7"
FT                   /protein_id="EAR00727.1"
FT                   /translation="MRNLYIFTLLLGFLTNAQTALYNSGNIRIHTNGQLGFHTNLINNA
FT                   AFDENVGLVGFYGSNQMNISGAIPPSFFDTEIANPNGVFLQTGINSLNNTNFVIGDYIT
FT                   PTEYIDSYYTFIESAFYVGDSDVSKVHGYAALSSQQNFTFPVGDTEQLRPLILNSQDVN
FT                   LLAYCAYFYENPNGSPTLNTSYDTAIKSHEIDQISTAEFWRLGGDALSSISISWNERST
FT                   ISNLTDDVNSIIVVGWSNVSNQWESLAGSVAVGDLSEGFVTSSNFIPSYYDIITFGSSR
FT                   SEPLDYLNLDNYLVSVNNDGINDFFYIPELEQSPNNHLQIYNRFGSKVFDQENYTNQFR
FT                   GISNVDNFVIQRENGLPTGVYFYIVSMQDLGLDFQGFLYLTR"
     MRNLYIFTLL LGFLTNAQTA LYNSGNIRIH TNGQLGFHTN LINNAAFDEN VGLVGFYGSN        60
     QMNISGAIPP SFFDTEIANP NGVFLQTGIN SLNNTNFVIG DYITPTEYID SYYTFIESAF       120
     YVGDSDVSKV HGYAALSSQQ NFTFPVGDTE QLRPLILNSQ DVNLLAYCAY FYENPNGSPT       180
     LNTSYDTAIK SHEIDQISTA EFWRLGGDAL SSISISWNER STISNLTDDV NSIIVVGWSN       240
     VSNQWESLAG SVAVGDLSEG FVTSSNFIPS YYDIITFGSS RSEPLDYLNL DNYLVSVNND       300
     GINDFFYIPE LEQSPNNHLQ IYNRFGSKVF DQENYTNQFR GISNVDNFVI QRENGLPTGV       360
     YFYIVSMQDL GLDFQGFLYL TR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page