(data stored in ACNUC7421 zone)

EMBL: CP002160.PE1

CP002160.PE1         Location/Qualifiers
FT   CDS             99..1454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   cno:NT01CX_0867 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49792"
FT                   /db_xref="GOA:D9SMK7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMK7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADL49792.1"
FT                   /translation="MNVHLSDIWDKTLTIIKGELTEVSFNTWIKSITPEYIDDTTITFG
FT                   VPNDFTRGILESRYKDLVINAINMVTSKKYNVEFKIISEDVITSDDSEPKIQKQHIIAT
FT                   VSPDEMNSVLNPKYTFNSFVIGNSNRFAHAACLAVAESPAKAYNPLFIYGGVGLGKTHL
FT                   MHAIGHYILKNNSKAKVAYVSSEKFTNELINSIKDDKNEEFRNKYRNVDLLLIDDIQFI
FT                   AGKERTQEEFFHTFNALYDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDF
FT                   ETRIAILKKKADVEKLNVPNEVLTYIATTIKSNIRELEGALIRIVAFSSLTNKEISVDL
FT                   AQEALKDIISNRATKQITIELIQEIVASYYNLKIEDFKSARRTKNIAYPRQIAMFLCRK
FT                   LTDNSLPKIGEEFGGRDHTTVIHAYEKINEAYKSDESLKNIIEILTKRINQN"
     MNVHLSDIWD KTLTIIKGEL TEVSFNTWIK SITPEYIDDT TITFGVPNDF TRGILESRYK        60
     DLVINAINMV TSKKYNVEFK IISEDVITSD DSEPKIQKQH IIATVSPDEM NSVLNPKYTF       120
     NSFVIGNSNR FAHAACLAVA ESPAKAYNPL FIYGGVGLGK THLMHAIGHY ILKNNSKAKV       180
     AYVSSEKFTN ELINSIKDDK NEEFRNKYRN VDLLLIDDIQ FIAGKERTQE EFFHTFNALY       240
     DANKQIILSS DRPPKEIPTL EDRLRSRFEW GLIADIQPPD FETRIAILKK KADVEKLNVP       300
     NEVLTYIATT IKSNIRELEG ALIRIVAFSS LTNKEISVDL AQEALKDIIS NRATKQITIE       360
     LIQEIVASYY NLKIEDFKSA RRTKNIAYPR QIAMFLCRKL TDNSLPKIGE EFGGRDHTTV       420
     IHAYEKINEA YKSDESLKNI IEILTKRINQ N                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page