(data stored in ACNUC7421 zone)

EMBL: CP002160.PE10

CP002160.PE10        Location/Qualifiers
FT   CDS             16516..19251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0010"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   cbf:CLI_0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49801"
FT                   /db_xref="GOA:D9SML6"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML6"
FT                   /inference="protein motif:PFAM:PF03699"
FT                   /protein_id="ADL49801.1"
FT                   /translation="MAYKNGVLKKFIVPIVVVFFLLVGFFNSIVNLIVNIQWYEEVKYL
FT                   AIYFTKLKSLAIVTIPLFFVFFILIFLYYKSIRKSFNKSRSAVDTGSNKRNKLVFLVDA
FT                   VISFFLSISIGNGFWYEILQFVNSTNFNDTDPIFNKDISFYIFKLPLLKGIYQVLLTTL
FT                   ILLIIATVIFYIAVTAYDRLNKTVNNNVINLNKSNIKIISMEIAQFAGKQLASLAALVL
FT                   LVTSYGYVLKGYEIVYSSAGVVYGASYTDVTITLNFFRAIAIVSFVAAIVVFMSILRKK
FT                   IKPIAVSVIAIFVLTAIQPLVSTATESIIVKSNQRNLEKKYIGYNIDYTRKAFDINDIK
FT                   YEEYDVNRNLTAEDINNNRGIIDNIKINSYKPALEFYNQVQSMKYYYDYNDIDIDRYTV
FT                   DGKFTQVFLGTRELNPASLTQGTNTWEGKHLLYTHGYGVAMSKVNSITESGKPNFIIKD
FT                   IPMENKSGIKIENPRIYFGEADSNYVIVNTKSGEVDYPEGGENKLNKYDGNGGIKLSFA
FT                   KKLLYAAYFGSEKILLSNEITADSKIMFNRTITDRINKIAPFLTYDRDPYMVISEGKLY
FT                   WIIDGYTTSNRYPMSQPYNNINYIRNSVKVVIDAYNGDTNFYISDEKDPLIQTYKKIYP
FT                   TLFKDLNTLSKDIISHFKYPEDIFDLQSEVLGKYHVTDPDVFFDGSDLWQVSKDDTDVS
FT                   NNANEAKNTDYQTLKLPKSNKSEMVVINYFNIRNKNNMSSMLVGRMDGENYGDLVAYRF
FT                   PSNESIYSPALFQKQFKQDAVISKELSLLNTQGSNVNYGDTVIVPMENSLLYIMPLYIR
FT                   ATGENSIPEVKKIVLSNGEKTVMGDNMEVALGLLFGDIKNTEKTDGTEGKNDSNTGNLT
FT                   LAKQAKDIYNKMIEAQKSGDWSAYGNYQKQLGEIIEQINK"
     MAYKNGVLKK FIVPIVVVFF LLVGFFNSIV NLIVNIQWYE EVKYLAIYFT KLKSLAIVTI        60
     PLFFVFFILI FLYYKSIRKS FNKSRSAVDT GSNKRNKLVF LVDAVISFFL SISIGNGFWY       120
     EILQFVNSTN FNDTDPIFNK DISFYIFKLP LLKGIYQVLL TTLILLIIAT VIFYIAVTAY       180
     DRLNKTVNNN VINLNKSNIK IISMEIAQFA GKQLASLAAL VLLVTSYGYV LKGYEIVYSS       240
     AGVVYGASYT DVTITLNFFR AIAIVSFVAA IVVFMSILRK KIKPIAVSVI AIFVLTAIQP       300
     LVSTATESII VKSNQRNLEK KYIGYNIDYT RKAFDINDIK YEEYDVNRNL TAEDINNNRG       360
     IIDNIKINSY KPALEFYNQV QSMKYYYDYN DIDIDRYTVD GKFTQVFLGT RELNPASLTQ       420
     GTNTWEGKHL LYTHGYGVAM SKVNSITESG KPNFIIKDIP MENKSGIKIE NPRIYFGEAD       480
     SNYVIVNTKS GEVDYPEGGE NKLNKYDGNG GIKLSFAKKL LYAAYFGSEK ILLSNEITAD       540
     SKIMFNRTIT DRINKIAPFL TYDRDPYMVI SEGKLYWIID GYTTSNRYPM SQPYNNINYI       600
     RNSVKVVIDA YNGDTNFYIS DEKDPLIQTY KKIYPTLFKD LNTLSKDIIS HFKYPEDIFD       660
     LQSEVLGKYH VTDPDVFFDG SDLWQVSKDD TDVSNNANEA KNTDYQTLKL PKSNKSEMVV       720
     INYFNIRNKN NMSSMLVGRM DGENYGDLVA YRFPSNESIY SPALFQKQFK QDAVISKELS       780
     LLNTQGSNVN YGDTVIVPME NSLLYIMPLY IRATGENSIP EVKKIVLSNG EKTVMGDNME       840
     VALGLLFGDI KNTEKTDGTE GKNDSNTGNL TLAKQAKDIY NKMIEAQKSG DWSAYGNYQK       900
     QLGEIIEQIN K                                                            911
//

If you have problems or comments...

PBIL Back to PBIL home page