(data stored in ACNUC7421 zone)

EMBL: CP002160.PE100

CP002160.PE100       Location/Qualifiers
FT   CDS             175327..176235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0102"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: cac:CAC0301 signal
FT                   peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49891"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM0"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADL49891.1"
FT                   /translation="MIEVVGVRFKKAGKVYYFSPGDLDIKEGDDVIVETARGLEFGNCI
FT                   IGHREVSEEDIISPLKSVVRVATPEDVIKYEENKKAEEEAFGICLEKIDKHELVMKLID
FT                   VEYTFDNNKIIFYFTAEGRVDFRELVKDLATIFRTRIELRQIGVRDEAKMLGGVGPCGR
FT                   PLCCTTFLGDFAPVSIKMAKEQNLSLNPSKISGICGRLMCCLNYEQETYEKTRRIMPTV
FT                   GSIVETAEGRGEIISSSIVKEKVTIKVTPPEGEWYLLEAPIVGLKLISGSYEGTVDEKD
FT                   IKLEVEDAADVKVIKELFKTD"
     MIEVVGVRFK KAGKVYYFSP GDLDIKEGDD VIVETARGLE FGNCIIGHRE VSEEDIISPL        60
     KSVVRVATPE DVIKYEENKK AEEEAFGICL EKIDKHELVM KLIDVEYTFD NNKIIFYFTA       120
     EGRVDFRELV KDLATIFRTR IELRQIGVRD EAKMLGGVGP CGRPLCCTTF LGDFAPVSIK       180
     MAKEQNLSLN PSKISGICGR LMCCLNYEQE TYEKTRRIMP TVGSIVETAE GRGEIISSSI       240
     VKEKVTIKVT PPEGEWYLLE APIVGLKLIS GSYEGTVDEK DIKLEVEDAA DVKVIKELFK       300
     TD                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page