(data stored in ACNUC7421 zone)

EMBL: CP002160.PE102

CP002160.PE102       Location/Qualifiers
FT   CDS             176538..176708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49893"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM2"
FT                   /inference="similar to AA sequence:KEGG:CLH_0200"
FT                   /protein_id="ADL49893.1"
FT                   /translation="MAYVINDSCISCGACASECPVSAINQGDAQYEINDSSCIDCGNCA
FT                   NVCPVGAPVQG"
     MAYVINDSCI SCGACASECP VSAINQGDAQ YEINDSSCID CGNCANVCPV GAPVQG            56
//

If you have problems or comments...

PBIL Back to PBIL home page