(data stored in ACNUC7421 zone)

EMBL: CP002160.PE104

CP002160.PE104       Location/Qualifiers
FT   CDS             178168..178902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0106"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: cno:NT01CX_0753
FT                   SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49895"
FT                   /db_xref="GOA:D9SNM4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM4"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADL49895.1"
FT                   /translation="MDFLKADETLDDLQLKDIQVIQKKDAFRFGVDAVLLANFANVKRS
FT                   HRVIDLCTGTGIIPFILAGKTESNSIVGIEIQDEFVEMADRTVEYNKLQERVSFHCRDL
FT                   KDLAFLKTLGLVDVVTVNPPYKLQNSGLINPNDKNAIARHEILCTLEDVIIASKAVLKD
FT                   NGRLYMVHRPDRLADIFCLMRKHNIEPKRVRMVHPSVGKAPNIVLVEGQKFGGAFLKWD
FT                   TPLYVHEEDGSYTREIDEIYGR"
     MDFLKADETL DDLQLKDIQV IQKKDAFRFG VDAVLLANFA NVKRSHRVID LCTGTGIIPF        60
     ILAGKTESNS IVGIEIQDEF VEMADRTVEY NKLQERVSFH CRDLKDLAFL KTLGLVDVVT       120
     VNPPYKLQNS GLINPNDKNA IARHEILCTL EDVIIASKAV LKDNGRLYMV HRPDRLADIF       180
     CLMRKHNIEP KRVRMVHPSV GKAPNIVLVE GQKFGGAFLK WDTPLYVHEE DGSYTREIDE       240
     IYGR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page