(data stored in ACNUC7421 zone)

EMBL: CP002160.PE106

CP002160.PE106       Location/Qualifiers
FT   CDS             180088..181260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0108"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: ctc:CTC00227 putative
FT                   cell wall-associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49897"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNM6"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL49897.1"
FT                   /translation="MNKRIAQLLVAVGLVISITLPSVSTYAVPTEAEVQASQAQVDEAR
FT                   AKVEAAEKKVAEITTEIQKYDQKITDLVIKKQETTENIGNTEADIKKTEEDIKAKQQEV
FT                   DENQKRFEERMKALYKRGGQNIIEILFDSKNLGELIGKIEGAKKIADHDKKLLADLEAQ
FT                   KQELKDKSEDLETKKKELVDLQQQQQQSIDQVNAEKAKQQPLLAQAEAQRAEVQALLNS
FT                   SEGAYAIIKAEYDEMEQKLTQGTGNSSTTGAGVSVEPSRGEILYSGDVGALLREAERLR
FT                   EKGIYYADAGTTEEGFDCSGFVQYVYRQCGYNITRTTYTQIKDGQPVEPNIASLRPGDL
FT                   VFFGDPYAPHHVGMYIGDGMYVHSPETGKKLQNAYLSNNSEFSAARRIIG"
     MNKRIAQLLV AVGLVISITL PSVSTYAVPT EAEVQASQAQ VDEARAKVEA AEKKVAEITT        60
     EIQKYDQKIT DLVIKKQETT ENIGNTEADI KKTEEDIKAK QQEVDENQKR FEERMKALYK       120
     RGGQNIIEIL FDSKNLGELI GKIEGAKKIA DHDKKLLADL EAQKQELKDK SEDLETKKKE       180
     LVDLQQQQQQ SIDQVNAEKA KQQPLLAQAE AQRAEVQALL NSSEGAYAII KAEYDEMEQK       240
     LTQGTGNSST TGAGVSVEPS RGEILYSGDV GALLREAERL REKGIYYADA GTTEEGFDCS       300
     GFVQYVYRQC GYNITRTTYT QIKDGQPVEP NIASLRPGDL VFFGDPYAPH HVGMYIGDGM       360
     YVHSPETGKK LQNAYLSNNS EFSAARRIIG                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page