(data stored in ACNUC7421 zone)

EMBL: CP002160.PE111

CP002160.PE111       Location/Qualifiers
FT   CDS             complement(186433..187086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0113"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbf:CLI_1460 manganese/zinc/iron chelate ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49902"
FT                   /db_xref="GOA:D9SNN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL49902.1"
FT                   /translation="MIEIKSLSFSYNNKAPYIVNDVSLKINKGEYVSIIGENGCGKSTL
FT                   IKLLLGIVKHSKGSVAINSPKIGYVPQRLDSNSSFPITVNEALQSHLKALKLKDKSLVD
FT                   NILDSLGMKKYKHRLIGSLSGGQQQKIFIARALLGEPEVLILDEPSNNIDVKSQEEIYG
FT                   IIKDLNLTKGVTVVSVEHNLKAARDNSTHIFEMTNNTTKLFDVEKYIAFSDLCE"
     MIEIKSLSFS YNNKAPYIVN DVSLKINKGE YVSIIGENGC GKSTLIKLLL GIVKHSKGSV        60
     AINSPKIGYV PQRLDSNSSF PITVNEALQS HLKALKLKDK SLVDNILDSL GMKKYKHRLI       120
     GSLSGGQQQK IFIARALLGE PEVLILDEPS NNIDVKSQEE IYGIIKDLNL TKGVTVVSVE       180
     HNLKAARDNS THIFEMTNNT TKLFDVEKYI AFSDLCE                                217
//

If you have problems or comments...

PBIL Back to PBIL home page