(data stored in ACNUC7421 zone)

EMBL: CP002160.PE112

CP002160.PE112       Location/Qualifiers
FT   CDS             187454..188662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0114"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: cno:NT01CX_0749 polyA polymerase family
FT                   protein; PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49903"
FT                   /db_xref="GOA:D9SNN2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN2"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="ADL49903.1"
FT                   /translation="MKETIQLLKSYMKNKEDKIYIVGEYVRDKLKDSSKEPKTLDIVVD
FT                   GNEACLIKYLEAHEFKFDKLKDKQRGHKKTKESEELYIWTNKGQNIEEYLQGVDFTVNA
FT                   IALDIKDNKMIDPYNGRRDIKSKLVNEVMQESISKAPIRIITAIKLSLENGMHLGGFTE
FT                   EHIRLYKDKIDESDKDELYEALLSLFSKDLYGNAIEFLDRYEILENIFPYIKEAKTIGK
FT                   CKYHVVNAYTHMEMTYRNFKDLISGRLSLNGIKDVLIDKLVQNFSLYDYIAISAFLHDI
FT                   GKFAAYKKENGQVSFTNHNELGARITEEALKKLGFPKEAIEIITTIIEGHMHPLRIFKA
FT                   GGMSQKKAIEDFFNKYKEIAPMIIAVSFCDVYATLSLKDDDNQEDAFKIFMENLIQEYR
FT                   TFI"
     MKETIQLLKS YMKNKEDKIY IVGEYVRDKL KDSSKEPKTL DIVVDGNEAC LIKYLEAHEF        60
     KFDKLKDKQR GHKKTKESEE LYIWTNKGQN IEEYLQGVDF TVNAIALDIK DNKMIDPYNG       120
     RRDIKSKLVN EVMQESISKA PIRIITAIKL SLENGMHLGG FTEEHIRLYK DKIDESDKDE       180
     LYEALLSLFS KDLYGNAIEF LDRYEILENI FPYIKEAKTI GKCKYHVVNA YTHMEMTYRN       240
     FKDLISGRLS LNGIKDVLID KLVQNFSLYD YIAISAFLHD IGKFAAYKKE NGQVSFTNHN       300
     ELGARITEEA LKKLGFPKEA IEIITTIIEG HMHPLRIFKA GGMSQKKAIE DFFNKYKEIA       360
     PMIIAVSFCD VYATLSLKDD DNQEDAFKIF MENLIQEYRT FI                          402
//

If you have problems or comments...

PBIL Back to PBIL home page