(data stored in ACNUC7421 zone)

EMBL: CP002160.PE113

CP002160.PE113       Location/Qualifiers
FT   CDS             189192..189659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN3"
FT                   /inference="similar to AA sequence:KEGG:Clos_2608"
FT                   /protein_id="ADL49904.1"
FT                   /translation="MRCEYIDKLINACAFVPDYKDNIGKVTKIYLKTGGCFVTRYSMRK
FT                   VIDDFCTINLTDINKLRKLSAELIGGKNLKPIYVRKGVVMIPIKTTKPLVDGDKCFAYV
FT                   NLHCIDDLYMDESIIRLNNGEEICYVESANAVKLRLAEGTILQNKVTLKGV"
     MRCEYIDKLI NACAFVPDYK DNIGKVTKIY LKTGGCFVTR YSMRKVIDDF CTINLTDINK        60
     LRKLSAELIG GKNLKPIYVR KGVVMIPIKT TKPLVDGDKC FAYVNLHCID DLYMDESIIR       120
     LNNGEEICYV ESANAVKLRL AEGTILQNKV TLKGV                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page