(data stored in ACNUC7421 zone)

EMBL: CP002160.PE115

CP002160.PE115       Location/Qualifiers
FT   CDS             190570..190728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49906"
FT                   /db_xref="GOA:D9SNN5"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN5"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0746"
FT                   /protein_id="ADL49906.1"
FT                   /translation="MDNIINLIGNVGFPIAISIYLLVRIEGKLESLTNSINVLSSAINR
FT                   IENNKNC"
     MDNIINLIGN VGFPIAISIY LLVRIEGKLE SLTNSINVLS SAINRIENNK NC                52
//

If you have problems or comments...

PBIL Back to PBIL home page