(data stored in ACNUC7421 zone)

EMBL: CP002160.PE117

CP002160.PE117       Location/Qualifiers
FT   CDS             192762..193505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0119"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: cno:NT01CX_0777 peptidil-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49908"
FT                   /db_xref="GOA:D9SNN7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN7"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADL49908.1"
FT                   /translation="MDNKVLAVVKNKEITEQNINELIVRMPDQQRMYYDTEQGRARLLE
FT                   ELVSVEVFYNYALELKLDESPAFLEQLEGAKRQMLFPIAADEVTKDVEIADQDVADFYK
FT                   NNRELFKKPELATASHILVDSEEKAQEIKAEIEAGLSFADAAAKYSTCPSNQRGGDLGQ
FT                   FQKGQMVPEFEEVAFTLPINKLSDPVKTQFGYHLIKVTDFQPEMIQDFDEVQVAIKEKM
FT                   LQDRRQYKFLEKVDELKKLYNVEYK"
     MDNKVLAVVK NKEITEQNIN ELIVRMPDQQ RMYYDTEQGR ARLLEELVSV EVFYNYALEL        60
     KLDESPAFLE QLEGAKRQML FPIAADEVTK DVEIADQDVA DFYKNNRELF KKPELATASH       120
     ILVDSEEKAQ EIKAEIEAGL SFADAAAKYS TCPSNQRGGD LGQFQKGQMV PEFEEVAFTL       180
     PINKLSDPVK TQFGYHLIKV TDFQPEMIQD FDEVQVAIKE KMLQDRRQYK FLEKVDELKK       240
     LYNVEYK                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page