(data stored in ACNUC7421 zone)

EMBL: CP002160.PE118

CP002160.PE118       Location/Qualifiers
FT   CDS             complement(193679..194119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gga:415947 RNA binding motif protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49909"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNN8"
FT                   /inference="similar to AA sequence:KEGG:415947"
FT                   /protein_id="ADL49909.1"
FT                   /translation="MGYKKDVDKDCFDYTIEDYDYDEMNDSDYTIKGKKDSRDKDCGCY
FT                   EYKKDKDYEDKDYDCYEYKKSKDYKKDKDYEDYEDNKEYGKYEEYEKCHEKPKKDKCKG
FT                   ETCCYGPYYEPYYVVKKCYRKYYIVKHCTWHRVPCCPKPRCK"
     MGYKKDVDKD CFDYTIEDYD YDEMNDSDYT IKGKKDSRDK DCGCYEYKKD KDYEDKDYDC        60
     YEYKKSKDYK KDKDYEDYED NKEYGKYEEY EKCHEKPKKD KCKGETCCYG PYYEPYYVVK       120
     KCYRKYYIVK HCTWHRVPCC PKPRCK                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page