(data stored in ACNUC7421 zone)

EMBL: CP002160.PE124

CP002160.PE124       Location/Qualifiers
FT   CDS             complement(204870..205337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0126"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: cpf:CPF_2616 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49915"
FT                   /db_xref="GOA:D9SNP4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADL49915.1"
FT                   /translation="MRIGMGYDVHKLVGGRDLIIGGVTIPYAKGLLGHSDADVLLHAIM
FT                   DSLLGAAALGDIGKHFPDTDAKYKGISSIKLLEEVGKLLKDNNFSIGNIDATIVAQAPK
FT                   MAPHITEMRKNISEALDISIDNINVKATTEEGLGFTGLGQGISSQSICLLV"
     MRIGMGYDVH KLVGGRDLII GGVTIPYAKG LLGHSDADVL LHAIMDSLLG AAALGDIGKH        60
     FPDTDAKYKG ISSIKLLEEV GKLLKDNNFS IGNIDATIVA QAPKMAPHIT EMRKNISEAL       120
     DISIDNINVK ATTEEGLGFT GLGQGISSQS ICLLV                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page