(data stored in ACNUC7421 zone)

EMBL: CP002160.PE125

CP002160.PE125       Location/Qualifiers
FT   CDS             complement(205794..205976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dap:Dacet_0900 heat shock protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49916"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP5"
FT                   /inference="similar to AA sequence:KEGG:Dacet_0900"
FT                   /protein_id="ADL49916.1"
FT                   /translation="MKNNVIYVDFSKPSRTTSKKKSPKASKVKFISKIKTFISNKIKKI
FT                   RVSSKHKNSPNVRIK"
     MKNNVIYVDF SKPSRTTSKK KSPKASKVKF ISKIKTFISN KIKKIRVSSK HKNSPNVRIK        60
//

If you have problems or comments...

PBIL Back to PBIL home page