(data stored in ACNUC7421 zone)

EMBL: CP002160.PE126

CP002160.PE126       Location/Qualifiers
FT   CDS             206087..206692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0128"
FT                   /product="sortase family protein"
FT                   /note="KEGG: cac:CAC0204 sortase; TIGRFAM: sortase family
FT                   protein; PFAM: peptidase C60 sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49917"
FT                   /db_xref="GOA:D9SNP6"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP6"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADL49917.1"
FT                   /translation="MEKKNKKNIWFIVGIILAVVGVIIILSAIYMNFKGKLENDKMISN
FT                   FEKKLEQVKDNNEKVEIKEQQDVIEEGTIGIMQIPKIGLKVAVGEGTDMETLKYAVGHF
FT                   KDTALPGELGNFAVAGHRSYTYNEFFNRLDEVTTGDKILVKTLKGTFTYEVTGTEVVEP
FT                   TQVEVLNKTDNATVTLVTCTPIRTATHRLIIKGVLVNN"
     MEKKNKKNIW FIVGIILAVV GVIIILSAIY MNFKGKLEND KMISNFEKKL EQVKDNNEKV        60
     EIKEQQDVIE EGTIGIMQIP KIGLKVAVGE GTDMETLKYA VGHFKDTALP GELGNFAVAG       120
     HRSYTYNEFF NRLDEVTTGD KILVKTLKGT FTYEVTGTEV VEPTQVEVLN KTDNATVTLV       180
     TCTPIRTATH RLIIKGVLVN N                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page