(data stored in ACNUC7421 zone)

EMBL: CP002160.PE127

CP002160.PE127       Location/Qualifiers
FT   CDS             complement(207153..207746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49918"
FT                   /db_xref="GOA:D9SNP7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP7"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0725"
FT                   /protein_id="ADL49918.1"
FT                   /translation="MLVSGLVLKIRRKYVIALDSNGYVIKIKIGSLTPLIGEIYHGTFL
FT                   ETKPSGYYFRKYKTPVLIITFIITISLIICSYLYYTPTTTVYIEASAQVTLSINRYNKV
FT                   VKAIALNSEGDKLLTSVRVKGTTLDESLNILYDGAIKNRIIDQYFAEAKQIYRVNIDSE
FT                   ANIDITSFLNTIKSSPYIIHINNKGNVIYNSQYK"
     MLVSGLVLKI RRKYVIALDS NGYVIKIKIG SLTPLIGEIY HGTFLETKPS GYYFRKYKTP        60
     VLIITFIITI SLIICSYLYY TPTTTVYIEA SAQVTLSINR YNKVVKAIAL NSEGDKLLTS       120
     VRVKGTTLDE SLNILYDGAI KNRIIDQYFA EAKQIYRVNI DSEANIDITS FLNTIKSSPY       180
     IIHINNKGNV IYNSQYK                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page