(data stored in ACNUC7421 zone)

EMBL: CP002160.PE128

CP002160.PE128       Location/Qualifiers
FT   CDS             complement(207736..208410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2521 putative RNA polymerase sigma
FT                   factor SigI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP8"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2521"
FT                   /protein_id="ADL49919.1"
FT                   /translation="MDDTPITVPNTKIEKLKDSKFFLQKLLGEIFNHEINWNKDPAVDI
FT                   ALIAMNHCFGSFDQEMGAFTMYSRTHVKNTVISYLIGLNNNFEFIEENSPLKATLDTLT
FT                   FEETEKYRELISAEIALFQEELKNYKISFAAFSSGAPQNTEDKNLSLNLAFYCIRNTSA
FT                   QNHIQSKHSLPINHLAKNFHIPASKIRSLKKYILALFLLFSIDDYFYLRAYLDIRIVKN
FT                   VS"
     MDDTPITVPN TKIEKLKDSK FFLQKLLGEI FNHEINWNKD PAVDIALIAM NHCFGSFDQE        60
     MGAFTMYSRT HVKNTVISYL IGLNNNFEFI EENSPLKATL DTLTFEETEK YRELISAEIA       120
     LFQEELKNYK ISFAAFSSGA PQNTEDKNLS LNLAFYCIRN TSAQNHIQSK HSLPINHLAK       180
     NFHIPASKIR SLKKYILALF LLFSIDDYFY LRAYLDIRIV KNVS                        224
//

If you have problems or comments...

PBIL Back to PBIL home page