(data stored in ACNUC7421 zone)

EMBL: CP002160.PE129

CP002160.PE129       Location/Qualifiers
FT   CDS             complement(208501..209106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_0646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49920"
FT                   /db_xref="GOA:D9SNP9"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNP9"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0646"
FT                   /protein_id="ADL49920.1"
FT                   /translation="MINEKKLSNSTRKLGTRQLTTVGMLSAICIILGITGYGFIPVGPV
FT                   KATIMHIPVIIGAIIEGPIVGALIGLMFGLFSLINNLVNPTAASFVFWNPIVSVLPRVL
FT                   IGIVSYYVYVGAIKLFKNNKISAGVGAFFGSLTNTALVLSLMYFLYADRLFEIYKVSSV
FT                   KQVGSALIAVASTNGIIEAIISVLITIPIVLAIKLVKK"
     MINEKKLSNS TRKLGTRQLT TVGMLSAICI ILGITGYGFI PVGPVKATIM HIPVIIGAII        60
     EGPIVGALIG LMFGLFSLIN NLVNPTAASF VFWNPIVSVL PRVLIGIVSY YVYVGAIKLF       120
     KNNKISAGVG AFFGSLTNTA LVLSLMYFLY ADRLFEIYKV SSVKQVGSAL IAVASTNGII       180
     EAIISVLITI PIVLAIKLVK K                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page